PDB entry 2c4o

View 2c4o on RCSB PDB site
Description: crystal structure of human ubiquitin-conjugating enzyme ubch5b
Class: ligase
Keywords: thioesterification, ubiquitin-conjugating enzyme, ligase, ubl conjugation pathway
Deposited on 2005-10-21, released 2006-11-22
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.227
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C4O (Start-17)
    • Uniprot P62837 (18-164)
    Domains in SCOPe 2.03: d2c4oa_
  • Chain 'B':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.03: d2c4ob_
  • Chain 'C':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.03: d2c4oc_
  • Chain 'D':
    Compound: ubiquitin-conjugating enzyme e2 d2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Domains in SCOPe 2.03: d2c4od_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4oA (A:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4oA (A:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c4oB (B:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4oB (B:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c4oC (C:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4oC (C:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c4oD (D:)
    mkhhhhhhpmsglvprgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpnd
    spyqggvffltihfptdypfkppkvafttriyhpninsngsicldilrsqwspaltiskv
    llsicsllcdpnpddplvpeiariyktdrekynriarewtqkyam
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4oD (D:)
    rgsmalkrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfp
    tdypfkppkvafttriyhpninsngsicldilrsqwspaltiskvllsicsllcdpnpdd
    plvpeiariyktdrekynriarewtqkyam