PDB entry 2c4l

View 2c4l on RCSB PDB site
Description: structure of neuraminidase subtype n9 complexed with 30 mm sialic acid (nana, neu5ac), crystal soaked for 24 hours at 291 k and finally backsoaked for 30 min in a cryoprotectant solution which did not contain neu5ac
Class: hydrolase
Keywords: hydrolase, influenza type a, neuraminidase, sialic acid, subtype n9, glycoprotein, glycosidase, transmembrane
Deposited on 2005-10-20, released 2007-03-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.157
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuraminidase subtype n9
    Species: INFLUENZA A VIRUS [TaxId:11320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c4la_
  • Heterogens: SIA, NAG, BMA, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c4lA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl