PDB entry 2c4k

View 2c4k on RCSB PDB site
Description: crystal structure of human phosphoribosylpyrophosphate synthetase-associated protein 39 (pap39)
Class: regulatory protein
Keywords: nucleotide biosynthesis, synthetase, ligase, regulatory protein
Deposited on 2005-10-20, released 2005-10-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.271
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4ka1, d2c4ka2
  • Chain 'B':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4kb1, d2c4kb2
  • Chain 'C':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4kc1, d2c4kc2
  • Chain 'D':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4kd1, d2c4kd2
  • Chain 'E':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4ke1, d2c4ke2
  • Chain 'F':
    Compound: phosphoribosyl pyrophosphate synthetase-associated protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c4kf1, d2c4kf2
  • Heterogens: SO4, TAM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4kA (A:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kA (A:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c4kB (B:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kB (B:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c4kC (C:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kC (C:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c4kD (D:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kD (D:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c4kE (E:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kE (E:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c4kF (F:)
    mhhhhhhssgvdlgtenlyfqsmrtgyrvfsanstaactelakriterlgaelgksvvyq
    etngetrveikesvrgqdifiiqtiprdvntavmellimayalktacarniigvipyfpy
    skqskmrkrgsivckllasmlakaglthiitmdlhqkeiqgffsfpvdnlraspfllqyi
    qeeipnyrnavivakspdaakraqsyaerlrlglavihgeaqcteldmddgrhsppmvkn
    atvhpglelplmmakekppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiy
    vmathgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihn
    gesmaylfrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4kF (F:)
    gyrvfsanstaactelakriterlgaelgksvvyqetngetrveikesvrgqdifiiqti
    prdvntavmellimayalktacarniigvipyfpyskqskmrkrgsivckllasmlakag
    lthiitmdlhqkeiqgffsfpvdnlraspfllqyiqeeipnyrnavivakspdaakraqs
    yaerlrlglavihppitvvgdvggriaiivddiiddvesfvaaaeilkergaykiyvmat
    hgilsaeaprlieessvdevvvtntvphevqklqcpkiktvdislilseairrihngesm
    aylfr