PDB entry 2c4b

View 2c4b on RCSB PDB site
Description: inhibitor cystine knot protein mcoeeti fused to the catalytically inactive barnase mutant h102a
Class: fusion protein
Keywords: squash inhibitor, hybrid microprotein, fusion protein, ribonuclease, endonuclease, hydrolase, nuclease, protease inhibitor, serine protease inhibitor
Deposited on 2005-10-18, released 2005-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-01-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.133
AEROSPACI score: 0.92 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: barnase mcoeeti fusion
    Species: BACILLUS AMYLOLIQUEFACIENS, MOMORDICA COCHINCHINENSIS, ECBALLIUM ELATERIUM, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-108)
      • engineered mutation (100)
    • PDB 2C4B (109-112)
    • Uniprot P82409 (113-128)
    • Uniprot P12071 (129-142)
    Domains in SCOP 1.75: d2c4ba1, d2c4ba2
  • Chain 'B':
    Compound: barnase mcoeeti fusion
    Species: BACILLUS AMYLOLIQUEFACIENS, MOMORDICA COCHINCHINENSIS, ECBALLIUM ELATERIUM, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00648 (Start-108)
      • engineered mutation (100)
    • PDB 2C4B (109-112)
    • Uniprot P82409 (113-128)
    • Uniprot P12071 (129-142)
    Domains in SCOP 1.75: d2c4bb1, d2c4bb2
  • Heterogens: SO4, 2PE, EDO, MES, UNX, GOL, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c4bA (A:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkirsssmgvcpkil
    kkcrrdsdclagcvcgpngfcgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4bA (A:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkirsssmgvcpkilk
    kcrrdsdclagcvcgpngfcgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c4bB (B:)
    qvintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnreg
    klpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkirsssmgvcpkil
    kkcrrdsdclagcvcgpngfcgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c4bB (B:)
    vintfdgvadylqtyhklpdnyitkseaqalgwvaskgnladvapgksiggdifsnregk
    lpgksgrtwreadinytsgfrnsdrilyssdwliykttdayqtftkirsssmgvcpkilk
    kcrrdsdclagcvcgpngfcgs