PDB entry 2c49

View 2c49 on RCSB PDB site
Description: crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family
Class: transferase
Keywords: transferase, nucleoside kinase, hyperthermophile, ribokinase family, ribokinase fold
Deposited on 2005-10-17, released 2006-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.245
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar kinase mj0406
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c49a_
  • Chain 'B':
    Compound: sugar kinase mj0406
    Species: Methanococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c49b_
  • Heterogens: ADN, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c49A (A:)
    mggkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnse
    llscvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakh
    ykelnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiieht
    nflfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvi
    dptgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekh
    ri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c49A (A:)
    gkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnsell
    scvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakhyk
    elnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiiehtnf
    lfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvidp
    tgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekhr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c49B (B:)
    mggkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnse
    llscvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakh
    ykelnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiieht
    nflfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvi
    dptgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekh
    ri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c49B (B:)
    gkmekitcvghtaldyifnvekfpepntsiqipsarkyyggaaantavgikklgvnsell
    scvgydfknsgyerylknldinisklyyseeeetpkawiftdkdnnqitfflwgaakhyk
    elnppnfnteivhiatgdpefnlkcakkaygnnlvsfdpgqdlpqyskemlleiiehtnf
    lfmnkheferasnllnfeiddylervdalivtkgskgsviytkdkkieipcikagkvidp
    tgagdsyragflsayvkgydlekcgligaatasfvveakgcqtnlptwdkvverlekh