PDB entry 2c47

View 2c47 on RCSB PDB site
Description: Structure of casein kinase 1 gamma 2
Class: transferase
Keywords: serine/threonine kinase, actin cytoskeleton organisation, ATP-binding, transferase, wnt signaling pathway
Deposited on 2005-10-16, released 2005-11-07
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-08-22, with a file datestamp of 2012-08-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: casein kinase 1 gamma 2 isoform
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c47a_
  • Chain 'B':
    Compound: casein kinase 1 gamma 2 isoform
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c47b_
  • Chain 'C':
    Compound: casein kinase 1 gamma 2 isoform
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2c47c_
  • Chain 'D':
    Compound: casein kinase 1 gamma 2 isoform
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P78368 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.04: d2c47d_
  • Heterogens: 5ID, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c47A (A:)
    smgpnfrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlsate
    gvpqvyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtks
    liyrdvkpenflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtaryms
    inthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlc
    enfpeematylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpigt
    vhtdlpsqpqlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c47A (A:)
    pnfrvgkkielrlgknlytneyvaiklepiksrapqlhleyrfykqlsategvpqvyyfg
    pcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtksliyrdvkpe
    nflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtarymsinthlgkeq
    srrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlcenfpeemat
    ylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c47B (B:)
    smgpnfrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlsate
    gvpqvyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtks
    liyrdvkpenflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtaryms
    inthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlc
    enfpeematylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpigt
    vhtdlpsqpqlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c47B (B:)
    pnfrvgkkigelrlgknlytneyvaiklepiksrapqlhleyrfykqlsategvpqvyyf
    gpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtksliyrdvkp
    enflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtarymsinthlgke
    qsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlcenfpeema
    tylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c47C (C:)
    smgpnfrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlsate
    gvpqvyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtks
    liyrdvkpenflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtaryms
    inthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlc
    enfpeematylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpigt
    vhtdlpsqpqlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c47C (C:)
    frvgkkielrlgknlytneyvaiklepiksrapqlhleyrfykqlsategvpqvyyfgpc
    gkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtksliyrdvkpenf
    lvgrpgqhaihiidfglakeyidpetkkhipyrehksltgtarymsinthlgkeqsrrdd
    lealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlcenfpeematylryv
    rrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c47D (D:)
    smgpnfrvgkkigcgnfgelrlgknlytneyvaiklepiksrapqlhleyrfykqlsate
    gvpqvyyfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtks
    liyrdvkpenflvgrpgtkrqhaihiidfglakeyidpetkkhipyrehksltgtaryms
    inthlgkeqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlc
    enfpeematylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpigt
    vhtdlpsqpqlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c47D (D:)
    mgpnfrvgkkigelrlgknlytneyvaiklepiksrapqlhleyrfykqlsategvpqvy
    yfgpcgkynamvlellgpsledlfdlcdrtftlktvlmiaiqlitrmeyvhtksliyrdv
    kpenflvgrpgtkrqhaihiidfglakeyidptkkhipyrehksltgtarymsinthlgk
    eqsrrddlealghmfmyflrgslpwqglkadtlkeryqkigdtkratpievlcenfpeem
    atylryvrrldffekpdydylrklftdlfdrsgfvfdyeydwagkplptpi