PDB entry 2c3y

View 2c3y on RCSB PDB site
Description: crystal structure of the radical form of pyruvate:ferredoxin oxidoreductase from desulfovibrio africanus
Class: oxidoreductase
Keywords: oxidoreductase, 4fe-4s, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, tpp-dependent enzyme, metal-binding, electron transport
Deposited on 2005-10-13, released 2006-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.186
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyruvate-ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c3ya1, d2c3ya2, d2c3ya3, d2c3ya4, d2c3ya5
  • Chain 'B':
    Compound: pyruvate-ferredoxin oxidoreductase
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c3yb1, d2c3yb2, d2c3yb3, d2c3yb4, d2c3yb5
  • Heterogens: SF4, HTL, MG, CA, CO2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c3yA (A:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c3yB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3yB (B:)
    gkkmmttdgntatahvayamsevaaiypitpsstmgeeaddwaaqgrknifgqtltirem
    qseagaagavhgalaagaltttftasqglllmipnmykisgellpgvfhvtaraiaahal
    sifgdhqdiyaarqtgfamlasssvqeahdmalvahlaaiesnvpfmhffdgfrtsheiq
    kievldyadmaslvnqkalaefraksmnpehphvrgtaqnpdiyfqgreaanpyylkvpg
    ivaeymqkvasltgrsyklfdyvgapdaervivsmgsscetieevinhlaakgekiglik
    vrlyrpfvseaffaalpasakvitvldrtkepgapgdplyldvcsafvergeampkilag
    ryglgskefspamvksvydnmsgakknhftvgieddvtgtslpvdnafadttpkgtiqcq
    fwglgadgtvgankqaikiigdntdlfaqgyfsydskksggitishlrfgekpiqstylv
    nradyvachnpayvgiydilegikdggtfvlnspwssledmdkhlpsgikrtiankklkf
    ynidavkiatdvglggrinmimqtaffklagvlpfekavdllkksihkaygkkgekivkm
    ntdavdqavtslqefkypdswkdapaetkaepmtneffknvvkpiltqqgdklpvsafea
    dgrfplgtsqfekrgvainvpqwvpenciqcnqcafvcphsailpvlakeeelvgapanf
    taleakgkelkgykfriqintldcmgcgncadicppkekalvmqpldtqrdaqvpnleya
    aripvksevlprdslkgsqfqeplmefsgacsgcgetpyvrvitqlfgermfianatgcs
    siwgasapsmpyktnrlgqgpawgnslfedaaeygfgmnmsmfarrthladlaakalesd
    asgdvkealqgwlagkndpikskeygdklkkllagqkdgllgqiaamsdlytkksvwifg
    gdgwaydigyggldhvlasgedvnvfvmdtevysntggqsskatptgavakfaaagkrtg
    kkdlarmvmtygyvyvatvsmgyskqqflkvlkeaesfpgpslviayatcinqglrkgmg
    ksqdvmntavksgywplfrydprlaaqgknpfqldskapdgsveeflmaqnrfavldrsf
    pedakrlraqvaheldvrfkelehmaatnifesfapaggkadgsvdfgegaefctrddtp
    mmarpdsgeacdqnragtseqqgdlskrtk