PDB entry 2c3n

View 2c3n on RCSB PDB site
Description: human glutathione-s-transferase t1-1, apo form
Class: transferase
Keywords: transferase, glutathione, glutathione transferase, t1-1, polymorphism
Deposited on 2005-10-11, released 2005-11-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.216
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase theta 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3N
    • Uniprot P30711 (8-246)
    Domains in SCOPe 2.07: d2c3na1, d2c3na2
  • Chain 'B':
    Compound: glutathione s-transferase theta 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3N
    • Uniprot P30711 (8-246)
    Domains in SCOPe 2.07: d2c3nb1, d2c3nb2
  • Chain 'C':
    Compound: glutathione s-transferase theta 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3N
    • Uniprot P30711 (8-246)
    Domains in SCOPe 2.07: d2c3nc1, d2c3nc2
  • Chain 'D':
    Compound: glutathione s-transferase theta 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3N
    • Uniprot P30711 (8-246)
    Domains in SCOPe 2.07: d2c3nd1, d2c3nd2
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c3nA (A:)
    mhhhhhhmglelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkk
    vpalkdgdftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclra
    lwhkvmfpvflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaite
    lmhpvgagcqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmp
    wvlamir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3nA (A:)
    glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
    ftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclralwhkvmfp
    vflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaitelmhpvgag
    cqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmpwvlamir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c3nB (B:)
    mhhhhhhmglelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkk
    vpalkdgdftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclra
    lwhkvmfpvflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaite
    lmhpvgagcqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmp
    wvlamir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3nB (B:)
    glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
    ftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclralwhkvmfp
    vflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaitelmhpvgag
    cqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmpwvlamir
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c3nC (C:)
    mhhhhhhmglelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkk
    vpalkdgdftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclra
    lwhkvmfpvflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaite
    lmhpvgagcqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmp
    wvlamir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3nC (C:)
    glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
    ftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclralwhkvmfp
    vflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaitelmhpvgag
    cqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmpwvlamir
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c3nD (D:)
    mhhhhhhmglelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkk
    vpalkdgdftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclra
    lwhkvmfpvflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaite
    lmhpvgagcqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmp
    wvlamir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3nD (D:)
    glelyldllsqpcravyifakkndipfelrivdlikgqhlsdafaqvnplkkvpalkdgd
    ftltesvaillyltrkykvpdywypqdlqararvdeylawqhttlrrsclralwhkvmfp
    vflgepvspqtlaatlaeldvtlqlledkflqnkafltgphisladlvaitelmhpvgag
    cqvfegrpklatwrqrveaavgedlfqeahevilkakdfppadptikqklmpwvlamir