PDB entry 2c3e

View 2c3e on RCSB PDB site
Description: The bovine mitochondrial ADP-ATP carrier
Class: transport protein
Keywords: mitochondrial carrier, nucleotide transport, membrane protein, transport protein
Deposited on 2005-10-06, released 2005-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-01-29, with a file datestamp of 2014-01-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.2497
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP/ATP translocase 1
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c3ea_
  • Heterogens: CXT, CDL

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c3eA (A:)
    sdqalsflkdflaggvaaaisktavapiervklllqvqhaskqisaekqykgiidcvvri
    pkeqgflsfwrgnlanviryfptqalnfafkdkykqiflggvdrhkqfwryfagnlasgg
    aagatslcfvypldfartrlaadvgkgaaqreftglgncitkifksdglrglyqgfnvsv
    qgiiiyraayfgvydtakgmlpdpknvhiivswmiaqtvtavaglvsypfdtvrrrmmmq
    sgrkgadimytgtvdcwrkiakdegpkaffkgawsnvlrgmggafvlvlydeikkfv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3eA (A:)
    sdqalsflkdflaggvaaaisktavapiervklllqvqhaskqisaekqykgiidcvvri
    pkeqgflsfwrgnlanviryfptqalnfafkdkykqiflggvdrhkqfwryfagnlasgg
    aagatslcfvypldfartrlaadvgkgaaqreftglgncitkifksdglrglyqgfnvsv
    qgiiiyraayfgvydtakgmlpdpknvhiivswmiaqtvtavaglvsypfdtvrrrmmmq
    sgrkgadimytgtvdcwrkiakdegpkaffkgawsnvlrgmggafvlvlydei