PDB entry 2c3c

View 2c3c on RCSB PDB site
Description: 2.01 angstrom x-ray crystal structure of a mixed disulfide between coenzyme m and nadph-dependent oxidoreductase 2-ketopropyl coenzyme m carboxylase
Class: oxidoreductase
Keywords: oxidoreductase, mixed disulfide, coenzyme m, redox-active center, fad
Deposited on 2005-10-05, released 2005-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.181
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-oxopropyl-com reductase
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c3ca1, d2c3ca2, d2c3ca3
  • Chain 'B':
    Compound: 2-oxopropyl-com reductase
    Species: XANTHOBACTER AUTOTROPHICUS [TaxId:78245]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c3cb1, d2c3cb2, d2c3cb3
  • Heterogens: COM, FAD, ACN, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c3cA (A:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3cA (A:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c3cB (B:)
    mkvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsa
    ylramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvv
    gikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlil
    avgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrt
    vmlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpnge
    mrietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpme
    mfkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmp
    pdtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqy
    lnvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3cB (B:)
    kvwnarndhltinqwatrideileapdggeviynvdendpreydaifigggaagrfgsay
    lramggrqlivdrwpflggscphnacvphhlfsdcaaelmlartfsgqywfpdmtekvvg
    ikevvdlfragrngphgimnfqskeqlnleyilncpakvidnhtveaagkvfkaknlila
    vgagpgtldvpgvnakgvfdhatlveeldyepgstvvvvggsktaveygcffnatgrrtv
    mlvrteplklikdnetrayvldrmkeqgmeiisgsnvtrieedangrvqavvamtpngem
    rietdfvflglgeqprsaelakilgldlgpkgevlvneylqtsvpnvyavgdliggpmem
    fkarksgcyaarnvmgekisytpknypdflhthyevsflgmgeeearaagheivtikmpp
    dtenglnvalpasdrtmlyafgkgtahmsgfqkividaktrkvlgahhvgygakdafqyl
    nvlikqgltvdelgdmdelflnpthfiqlsrlragsknlvsl