PDB entry 2c3b

View 2c3b on RCSB PDB site
Description: the crystal structure of aspergillus fumigatus cyclophilin reveals 3d domain swapping of a central element
Class: isomerase
Keywords: isomerase, 3d domain swapping, misfolding, ppiase, asp f 11, allergen, rotamase
Deposited on 2005-10-05, released 2006-01-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.191
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ppiase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3B (0-0)
    • Uniprot Q9Y7F6 (1-171)
    Domains in SCOPe 2.06: d2c3ba1
  • Chain 'B':
    Compound: ppiase
    Species: Aspergillus fumigatus [TaxId:5085]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C3B
    • Uniprot Q9Y7F6 (1-171)
    Domains in SCOPe 2.06: d2c3bb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c3bA (A:)
    smsqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhri
    ipnfmiqggdftrgngtggrsiygdkfadenfsrkhdkkgilsmanagpntngsqffitt
    avtswldgkhvvfgevadeksysvvkeiealgsssgsvrsntrpkivncgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3bA (A:)
    smsqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhri
    ipnfmiqggdsrkhdkkgilsmaqffittavtswldgkhvvfgevadeksysvvkeieal
    gsssgsvrsntrpkivncgel
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c3bB (B:)
    smsqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhri
    ipnfmiqggdftrgngtggrsiygdkfadenfsrkhdkkgilsmanagpntngsqffitt
    avtswldgkhvvfgevadeksysvvkeiealgsssgsvrsntrpkivncgel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c3bB (B:)
    msqvffdveyapvgtaetkvgrivfnlfdkdvpktaknfrelckrpagegyrestfhrii
    pnfmiqggdkkgilsmasqffittavtswldgkhvvfgevadeksysvvkeiealgsssg
    svrsntrpkivncgel