PDB entry 2c38

View 2c38 on RCSB PDB site
Description: RNAse ph core of the archaeal exosome in complex with a5 RNA
Class: hydrolase
Keywords: exosome, RNAse ph, rrp41, rrp42, phosphorolytic, exoribonuclease, RNA degradation, archaeal, hydrolase, exonuclease, nuclease
Deposited on 2005-10-04, released 2005-11-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.276
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38a1, d2c38a2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38b1, d2c38b2
  • Chain 'C':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38c1, d2c38c2
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38d1, d2c38d2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38e1, d2c38e2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38f1, d2c38f2
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38g1, d2c38g2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38h1, d2c38h2
  • Chain 'I':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38i1, d2c38i2
  • Chain 'J':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38j1, d2c38j2
  • Chain 'K':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38k1, d2c38k2
  • Chain 'L':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38l1, d2c38l2
  • Chain 'M':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38m1, d2c38m2
  • Chain 'N':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38n1, d2c38n2
  • Chain 'O':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38o1, d2c38o2
  • Chain 'P':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38p1, d2c38p2
  • Chain 'Q':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38q1, d2c38q2
  • Chain 'R':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38r1, d2c38r2
  • Chain 'S':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38s1, d2c38s2
  • Chain 'T':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38t1, d2c38t2
  • Chain 'U':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38u1, d2c38u2
  • Chain 'V':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38v1, d2c38v2
  • Chain 'W':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38w1, d2c38w2
  • Chain 'X':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2c38x1, d2c38x2
  • Heterogens: CL, AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c38A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c38B (B:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c38C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c38D (D:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38D (D:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c38E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c38F (F:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38F (F:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2c38G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c38H (H:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38H (H:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2c38I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2c38J (J:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38J (J:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2c38K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c38L (L:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38L (L:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2c38M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2c38N (N:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38N (N:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2c38O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c38P (P:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2c38Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2c38R (R:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38R (R:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2c38S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2c38T (T:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38T (T:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2c38U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2c38V (V:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38V (V:)
    rpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhprh
    lslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidvf
    teilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgead
    mpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2c38W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnk
    nevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkg
    smslqdidqaentarstavklleelkkhlgi
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2c38X (X:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c38X (X:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v