PDB entry 2c37

View 2c37 on RCSB PDB site
Description: RNAse ph core of the archaeal exosome in complex with u8 RNA
Class: hydrolase
Keywords: exosome, RNAse ph, rrp41, rrp42, phosphorolytic, exoribonuclease, RNA degradation, archaeal, hydrolase
Deposited on 2005-10-04, released 2005-11-23
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-23, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.267
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37a1, d2c37a2
  • Chain 'B':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37b1, d2c37b2
  • Chain 'C':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37c1, d2c37c2
  • Chain 'D':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37d1, d2c37d2
  • Chain 'E':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37e1, d2c37e2
  • Chain 'F':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37f1, d2c37f2
  • Chain 'G':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37g1, d2c37g2
  • Chain 'H':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37h1, d2c37h2
  • Chain 'I':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37i1, d2c37i2
  • Chain 'J':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37j1, d2c37j2
  • Chain 'K':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37k1, d2c37k2
  • Chain 'L':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37l1, d2c37l2
  • Chain 'M':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37m1, d2c37m2
  • Chain 'N':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37n1, d2c37n2
  • Chain 'O':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37o1, d2c37o2
  • Chain 'P':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37p1, d2c37p2
  • Chain 'Q':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37q1, d2c37q2
  • Chain 'R':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37r1, d2c37r2
  • Chain 'S':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37s1, d2c37s2
  • Chain 'T':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37t1, d2c37t2
  • Chain 'U':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37u1, d2c37u2
  • Chain 'V':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37v1, d2c37v2
  • Chain 'W':
    Compound: probable exosome complex exonuclease 2
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37w1, d2c37w2
  • Chain 'X':
    Compound: probable exosome complex exonuclease 1
    Species: Sulfolobus solfataricus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2c37x1, d2c37x2
  • Heterogens: CL, NA, U5P, RP5

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c37A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37A (A:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c37B (B:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37B (B:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c37C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37C (C:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c37D (D:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37D (D:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c37E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37E (E:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c37F (F:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37F (F:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2c37G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37G (G:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c37H (H:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37H (H:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2c37I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37I (I:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2c37J (J:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37J (J:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2c37K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37K (K:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c37L (L:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37L (L:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2c37M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37M (M:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2c37N (N:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37N (N:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2c37O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37O (O:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c37P (P:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2c37Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37Q (Q:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2c37R (R:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37R (R:)
    mlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpke
    mhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprt
    aidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedm
    wgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvef
    keegv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2c37S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37S (S:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2c37T (T:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37T (T:)
    remlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygp
    kemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfp
    rtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnete
    dmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyv
    efkeegv
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2c37U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37U (U:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2c37V (V:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37V (V:)
    lqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkem
    hprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprta
    idvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmw
    geadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefk
    eegv
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2c37W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellplayetfepgppdenaielarvvdrslrd
    skaldltklviepgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqhsngi
    svnknevvgklplnypvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqk
    sgkgsmslqdidqaentarstavklleelkkhlgi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37W (W:)
    msstpsnqniipiikkesivslfekgirqdgrkltdyrplsitldyakkadgsalvklgt
    tmvlagtkleidkpyedtpnqgnlivnvellpdenaielarvvdrslrdskaldltklvi
    epgksvwtvwldvyvldyggnvldactlasvaalyntkvykveqisvnknevvgklplny
    pvvtisvakvdkylvvdpdldeesimdakisfsytpdlkivgiqksgkgsmslqdidqae
    ntarstavklleelkkhlgi
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2c37X (X:)
    mremlqverpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavyg
    pkemhprhlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelf
    prtaidvfteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnet
    edmwgeadmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealksky
    vefkeegv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c37X (X:)
    erpklilddgkrtdgrkpdelrsikielgvlknadgsaifemgntkaiaavygpkemhpr
    hlslpdravlrvryhmtpfstderknpapsrreielskvirealesavlvelfprtaidv
    fteilqadagsrlvslmaaslaladagipmrdliagvavgkadgviildlnetedmwgea
    dmpiammpslnqvtlfqlngsmtpdefrqafdlavkginiiynlerealkskyvefkeeg
    v