PDB entry 2c35

View 2c35 on RCSB PDB site
Description: Subunits Rpb4 and Rpb7 of human RNA polymerase II
Class: transferase
Keywords: transcription, RNA polymerase II, polymerase, nucleotidyltransferase, transferase
Deposited on 2005-10-04, released 2005-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-03-27, with a file datestamp of 2013-03-22.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase II 16 kda polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C35
    • Uniprot O15514 (Start-151)
    Domains in SCOPe 2.06: d2c35a1
  • Chain 'B':
    Compound: DNA-directed RNA polymerase II 19 kDa polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35b1, d2c35b2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase II 16 kda polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2C35
    • Uniprot O15514 (Start-151)
    Domains in SCOPe 2.06: d2c35c_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase II 19 kDa polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35d1, d2c35d2
  • Chain 'E':
    Compound: DNA-directed RNA polymerase II 16 kda polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35e_
  • Chain 'F':
    Compound: DNA-directed RNA polymerase II 19 kDa polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35f1, d2c35f2
  • Chain 'G':
    Compound: DNA-directed RNA polymerase II 16 kda polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35g_
  • Chain 'H':
    Compound: DNA-directed RNA polymerase II 19 kDa polypeptide
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c35h1, d2c35h2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c35A (A:)
    gsrrasvgsqmaaggsdpragdveedasqlifpkefetaetllnsevhmllehrkqqnes
    aedeqelsevfmktlnytarfsrfknretiasvrslllqkklhkfelaclanlcpetaee
    skalipslegrfedeelqqilddiqtkrsfqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35A (A:)
    eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
    fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
    iqtkrsfqy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c35B (B:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35B (B:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c35C (C:)
    gsrrasvgsqmaaggsdpragdveedasqlifpkefetaetllnsevhmllehrkqqnes
    aedeqelsevfmktlnytarfsrfknretiasvrslllqkklhkfelaclanlcpetaee
    skalipslegrfedeelqqilddiqtkrsfqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35C (C:)
    eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
    fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
    iqtkrsfqy
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c35D (D:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35D (D:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c35E (E:)
    gsrrasvgsqmaaggsdpragdveedasqlifpkefetaetllnsevhmllehrkqqnes
    aedeqelsevfmktlnytarfsrfknretiasvrslllqkklhkfelaclanlcpetaee
    skalipslegrfedeelqqilddiqtkrsfqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35E (E:)
    eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
    fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
    iqtkrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c35F (F:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35F (F:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2c35G (G:)
    gsrrasvgsqmaaggsdpragdveedasqlifpkefetaetllnsevhmllehrkqqnes
    aedeqelsevfmktlnytarfsrfknretiasvrslllqkklhkfelaclanlcpetaee
    skalipslegrfedeelqqilddiqtkrsfqy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35G (G:)
    eedasqlifpkefetaetllnsevhmllehrkqqnesaedeqelsevfmktlnytarfsr
    fknretiasvrslllqkklhkfelaclanlcpetaeeskalipslegrfedeelqqildd
    iqtkrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c35H (H:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c35H (H:)
    mfyhisleheillhpryfgpnllntvkqklftevegtctgkygfviavttidnigagviq
    pgrgfvlypvkykaivfrpfkgevvdavvtqvnkvglfteigpmscfisrhsipsemefd
    pnsnppcyktmdediviqqddeirlkivgtrvdkndifaigslmddylglv