PDB entry 2c34

View 2c34 on RCSB PDB site
Description: Leishmania mexicana ICP
Class: inhibitor
Keywords: icp, chagasin, cysteine peptidase, inhibitor, immunoglobulin fold
Deposited on 2005-10-04, released 2005-12-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-06-23, with a file datestamp of 2021-06-18.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inhibitor of cysteine peptidases
    Species: Leishmania mexicana [TaxId:5665]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C34 (0-2)
    • Uniprot Q868H1 (3-115)
    Domains in SCOPe 2.08: d2c34a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c34A (A:)
    gshmiaplsvkdndkwvdthvgktteihlkgnpttgymwtrvgfvgkdvlsdeilevvck
    ytptpsstpmvgvggiyvvlvkprkrghhtlelvytrpfegikpenerytlhlnvk