PDB entry 2c2v

View 2c2v on RCSB PDB site
Description: crystal structure of the chip-ubc13-uev1a complex
Class: chaperone
Keywords: chaperone, heat-shock protein complex, e3 ligase, ubiquitinylation, tpr, heat-shock protein
Deposited on 2005-09-30, released 2005-11-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.218
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2V (0-1)
      • conflict (2)
    • Uniprot P61089 (2-153)
    Domains in SCOPe 2.03: d2c2vb_
  • Chain 'C':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vc1
  • Chain 'E':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2V
    • Uniprot P61089 (Start-153)
    Domains in SCOPe 2.03: d2c2ve_
  • Chain 'F':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vf_
  • Chain 'H':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2V
    • Uniprot P61089 (Start-153)
    Domains in SCOPe 2.03: d2c2vh_
  • Chain 'I':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vi_
  • Chain 'K':
    Compound: Ubiquitin-conjugating enzyme E2 N
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2V (0-1)
      • conflict (2)
    • Uniprot P61089 (2-153)
    Domains in SCOPe 2.03: d2c2vk_
  • Chain 'L':
    Compound: Ubiquitin-conjugating enzyme E2 variant 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vl_
  • Chain 'S':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vs1
  • Chain 'T':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vt_
  • Chain 'U':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vu_
  • Chain 'V':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2c2vv_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c2vB (B:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vB (B:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dpndvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2vC (C:)
    ttgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriy
    slkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelr
    rlmmskenmklpqppegqcysn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2c2vE (E:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vE (E:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpn
    dvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c2vF (F:)
    ttgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriy
    slkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelr
    rlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vF (F:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
    iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqcysn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c2vH (H:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vH (H:)
    aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
    ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpn
    dvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2c2vI (I:)
    ttgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriy
    slkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelr
    rlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vI (I:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
    iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqcysn
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2c2vK (K:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dplandvaeqwktneaqaietarawtrlyamnni
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vK (K:)
    agsaglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelfl
    peeypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpd
    dpndvaeqwktneaqaietarawtrlyamnni
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c2vL (L:)
    ttgvkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriy
    slkiecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelr
    rlmmskenmklpqppegqcysn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vL (L:)
    vkvprnfrlleeleegqkgvgdgtvswgleddedmtltrwtgmilgpprtiyenriyslk
    iecgpkypeappfvrfvtkinmngvnssngvvdpraisvlakwqnsysikvvlqelrrlm
    mskenmklpqppegqcysn
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2c2vS (S:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafisengwvedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vS (S:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafisengwv
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2vT (T:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafisengwvedy
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2c2vU (U:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafisengwvedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vU (U:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafiseng
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2c2vV (V:)
    dipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnla
    mkevidafisengwvedy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2vV (V:)
    pdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipnlamk
    evidafiseng