PDB entry 2c2r

View 2c2r on RCSB PDB site
Description: efficient and high fidelity incorporation of dctp opposite 7,8-dihydro-8-oxodeoxyguanosine by sulfolobus solfataricus DNA polymerase dpo4
Class: polymerase
Keywords: p2 DNA polymerase IV, 7,8-dihydro-8-oxodeoxyguanosine, translesion DNA polymerase, nucleotidyltransferase, transferase, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, magnesium, calcium, metal-binding, mutator protein
Deposited on 2005-09-29, released 2005-11-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.251
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c2ra1, d2c2ra2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*c)-3'
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*c 8ogp*gp*ap*ap*tp*cp*cp *tp*tp*cp*cp*cp*cp*c)-3'
  • Heterogens: CA, DCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2rA (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2rA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.