PDB entry 2c2d

View 2c2d on RCSB PDB site
Description: Efficient and High Fidelity Incorporation of dCTP Opposite 7,8- Dihydro-8-oxodeoxyguanosine by Sulfolobus solfataricus DNA Polymerase Dpo4
Class: polymerase
Keywords: polymerase, p2 DNA polymerase IV, 8-oxo-2p-deoxy-guanosine-5p- monophosphate, translesion DNA polymerase, datp, nucleotidyltransferase, transferase, DNA damage, DNA repair, DNA replication, DNA-binding, DNA-directed DNA polymerase, metal-binding, mutator protein, magnesium
Deposited on 2005-09-27, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase IV
    Species: SULFOLOBUS SOLFATARICUS [TaxId:273057]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2D
    • Uniprot Q97W02 (6-End)
    Domains in SCOPe 2.08: d2c2da1, d2c2da2
  • Chain 'P':
    Compound: 5'-d(*gp*gp*gp*gp*gp*ap*ap*gp*gp*ap *tp*tp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Chain 'T':
    Compound: 5'-d(*tp*cp*ap*c 8ogp*gp*ap*ap*tp*cp*cp *tp*tp*cp*cp*cp*cp*c)-3'
    Species: synthetic construct, synthetic [TaxId:32630]
  • Heterogens: DTP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2dA (A:)
    hhhhhhmivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfg
    vkagipiveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdk
    vrdyreaynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrl
    ireldiadvpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeyn
    epirtrvrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedld
    ivsrgrtfphgisketaysesvkllqkileederkirrigvrfskfieaigldkffdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2dA (A:)
    mivlfvdfdyfyaqveevlnpslkgkpvvvcvfsgrfedsgavatanyearkfgvkagip
    iveakkilpnavylpmrkevyqqvssrimnllreysekieiasideayldisdkvrdyre
    aynlgleiknkilekekitvtvgisknkvfakiaadmakpngikviddeevkrlireldi
    advpgignitaeklkklginklvdtlsiefdklkgmigeakakylislardeynepirtr
    vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
    tfphgisketaysesvkllqkileederkirrigvrfskfie
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.