PDB entry 2c2a

View 2c2a on RCSB PDB site
Description: structure of the entire cytoplasmic portion of a sensor histidine kinase protein
Class: transferase
Keywords: histidine kinase,phosphotransfer, phoq, selenomethionyl mad, two-component systems, transferase
Deposited on 2005-09-27, released 2005-11-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.2465
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sensor histidine kinase
    Species: THERMOTOGA MARITIMA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c2aa1, d2c2aa2
  • Heterogens: SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c2aA (A:)
    menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdssltyevpgtglglaitkeivelhggriwvesevgkgsr
    ffvwipkdragednrqdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c2aA (A:)
    menvteskelerlkridrmktefianishelrtpltaikayaetiynslgeldlstlkef
    leviidqsnhlenllnelldfsrlerkslqinrekvdlcdlvesavnaikefasshnvnv
    lfesnvpcpveayidptrirqvllnllnngvkyskkdapdkyvkvildekdggvliived
    ngigipdhakdrifeqfyrvdtglglaitkeivelhggriwvesevgkgsrffvwipkdr
    a