PDB entry 2c27

View 2c27 on RCSB PDB site
Description: the structure of mycothiol synthase in complex with des-acetylmycothiol and coenzymea.
Class: synthase
Keywords: mycobacterium tuberculosis, mycothiol synthase, des-acetylmycothiol, acetyltransferase, gnat, gcn5 related n-acetyltransferase
Deposited on 2005-09-26, released 2005-12-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.161
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mycothiol synthase
    Species: MYCOBACTERIUM TUBERCULOSIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c27a1
  • Heterogens: ACO, COA, MA8, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c27A (A:)
    mtaldwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsrpggp
    iigylnlspprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldpara
    tasalglvgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeq
    ggwtavqlaerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgv
    dpaaqrrglgqmltsigivslarrlggrktldpavepavllyvesdnvaavrtyqslgft
    tysvdtayalagtdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c27A (A:)
    dwrsaltadeqrsvralvtattavdgvapvgeqvlrelgqqrtehllvagsgpiigylnl
    spprgaggamaelvvhpqsrrrgigtamaraalaktagrnqfwahgtldparatasalgl
    vgvreliqmrrplrdipeptipdgvvirtyagtsddaellrvnnaafaghpeqggwtavq
    laerrgeawfdpdglilafgdsprerpgrllgfhwtkvhpdhpglgevyvlgvdpaaqrr
    glgqmltsigivslarrlktldpavepavllyvesdnvaavrtyqslgfttysvdtayal
    ag