PDB entry 2c1y

View 2c1y on RCSB PDB site
Description: structure of pdi-related chaperone, wind mutant-y55k
Class: chaperone
Keywords: wind, windbeutel, pdi-dbeta, pdi, protein disulfide isomerase, pipe, dorsal-ventral patterning, chaperone, wind mutants, developmental protein, endoplasmic reticulum
Deposited on 2005-09-22, released 2006-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.226
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: windbeutel protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1Y
      • engineered mutation (45)
    • Uniprot O44342
    Domains in SCOPe 2.04: d2c1ya1, d2c1ya2
  • Chain 'B':
    Compound: windbeutel protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1Y
      • engineered mutation (45)
    • Uniprot O44342 (12-End)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1yA (A:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiaypkgekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1yA (A:)
    tctgcvdldelsfektverfpysvvkfdiaypkgekheaftafsksahkatkdlliatvg
    vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl
    yigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkih
    evgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktape
    

  • Chain 'B':
    No sequence available.