PDB entry 2c1x

View 2c1x on RCSB PDB site
Description: structure and activity of a flavonoid 3-o glucosyltransferase reveals the basis for plant natural product modification
Class: transferase
Keywords: glycosyltransferase, flavonoid, wine, catalysis, glycosylation, transferase
Deposited on 2005-09-22, released 2006-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-glucose flavonoid 3-o glycosyltransferase
    Species: Vitis vinifera [TaxId:29760]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O22304 (Start-455)
      • conflict (133)
    Domains in SCOPe 2.06: d2c1xa1
  • Heterogens: UDP, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1xA (A:)
    msqtttnphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifhdsmhtm
    qcniksydisdgvpegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvada
    fiwfaadmaaemgvawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgms
    kvrfrdlqegivfgnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklkty
    lnigpfnlitpppvvpnttgclqwlkerkptsvvyisfgtvttpppaevvalsealeasr
    vpfiwslrdkarvhlpegflektrgygmvvpwapqaevlaheavgafvthcgwnslwesv
    aggvplicrpffgdqrlngrmvedvleigvrieggvftksglmscfdqilsqekgkklre
    nlralretadravgpkgsstenfitlvdlvskpkdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1xA (A:)
    nphvavlafpfsthaapllavvrrlaaaaphavfsffstsqsnasifqcniksydisdgv
    pegyvfagrpqedielftraapesfrqgmvmavaetgrpvsclvadafiwfaadmaaemg
    vawlpfwtagpnslsthvyideirekigvsgiqgredellnfipgmskvrfrdlqegivf
    gnlnslfsrmlhrmgqvlpkatavfinsfeelddsltndlksklktylnigpfnlitgcl
    qwlkerkptsvvyisfgtvttpppaevvalsealeasrvpfiwslrdkarvhlpegflek
    trgygmvvpwapqaevlaheavgafvthcgwnslwesvaggvplicrpffgdqrlngrmv
    edvleigvrieggvftksglmscfdqilsqekgkklrenlralretadravgpkgssten
    fitlvdlvskpkdv