PDB entry 2c1t

View 2c1t on RCSB PDB site
Description: structure of the kap60p:nup2 complex
Class: nuclear transport/complex
Keywords: armadillo repeat, karyopherin recycling, nls release, nucear import, nuclear protein, nucleoporin, protein transport, nuclear transport/complex, nuclear pore complex, phosphorylation, translocation
Deposited on 2005-09-20, released 2005-11-22
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.20537
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin alpha subunit
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-End)
      • engineered mutation (309)
    Domains in SCOP 1.73: d2c1ta1
  • Chain 'B':
    Compound: importin alpha subunit
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02821 (0-End)
      • engineered mutation (309)
    Domains in SCOP 1.73: d2c1tb1
  • Chain 'C':
    Compound: nucleoporin nup2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: nucleoporin nup2
    Species: SACCHAROMYCES CEREVISIAE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1tA (A:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnagntfgfgsnvnqqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1tA (A:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c1tB (B:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfgeeedavdetmapqnagntfgfgsnvnqqfnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1tB (B:)
    elpqmtqqlnsddmqeqlsatvkfrqilsrehrppidvviqagvvprlvefmrenqpeml
    qleaawaltniasgtsaqtkvvvdadavplfiqllytgsvevkeqaiwalgnvagdstdy
    rdyvlqcnamepilglfnsnkpslirtatwtlsnlcrgkkpqpdwsvvsqalptlakliy
    smdtetlvdacwaisylsdgpqeaiqavidvripkrlvellshestlvqtpalravgniv
    tgndlqtqvvinagvlpalrlllsspkenikkeacwtisnitagnteqiqavidanlipp
    lvkllevaedktkkeacwaisnassgglqrpdiirylvsqgcikplcdlleiadnriiev
    tldalenilkmgeadkearglninenadfiekaggmekifncqqnendkiyekaykiiet
    yfg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.