PDB entry 2c1s

View 2c1s on RCSB PDB site
Description: x-ray structure of biotin binding protein from chicken
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2005-09-19, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.195
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin binding protein a
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1S
    Domains in SCOPe 2.06: d2c1sa_
  • Chain 'B':
    Compound: biotin binding protein a
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1S
    Domains in SCOPe 2.06: d2c1sb_
  • Heterogens: BSO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1sA (A:)
    gtrkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtk
    gqqptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtn
    vftrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1sA (A:)
    rkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtkgq
    qptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvf
    trv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c1sB (B:)
    gtrkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtk
    gqqptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtn
    vftrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1sB (B:)
    rkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtkgq
    qptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvf
    trv