PDB entry 2c1q

View 2c1q on RCSB PDB site
Description: x-ray structure of biotin binding protein from chicken
Class: biotin binding protein
Keywords: biotin binding protein
Deposited on 2005-09-19, released 2007-02-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.196
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin binding protein a
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1Q (Start-125)
    Domains in SCOPe 2.06: d2c1qa_
  • Heterogens: BTN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1qA (A:)
    gtrkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppgtk
    gqqptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtn
    vftrvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1qA (A:)
    trkcelqglwrnelgsnmtisaldvagtfsgsyqtavtatnkqilvsplkgaqqppkgqq
    ptfgftvqwqfadsttvfvgqcfvdrrgkemlemawllreevpsrkdtwkatrvgtnvft
    rvk