PDB entry 2c1p

View 2c1p on RCSB PDB site
Description: Fab-fragment of enantioselective antibody complexed with finrozole
Class: immune system
Keywords: fab fragment, enantioselective, finrozole, immune system, antibody, enantioselective antibody, immunoglobulin domain
Deposited on 2005-09-19, released 2006-01-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igk-c protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1P (0-217)
    Domains in SCOPe 2.08: d2c1pa1, d2c1pa2
  • Chain 'B':
    Compound: igh-4 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1P (102-216)
    Domains in SCOPe 2.08: d2c1pb_
  • Chain 'H':
    Compound: igh-4 protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1P (102-End)
    Domains in SCOPe 2.08: d2c1ph_
  • Chain 'L':
    Compound: igk-c protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1P (Start-217)
    Domains in SCOPe 2.08: d2c1pl1, d2c1pl2
  • Heterogens: FNZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1pA (A:)
    elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1pB (B:)
    vqlqqsgaelvrpgtsvklsckasgysftnywmnwlrqrpgqgldwigmihpsdsetrln
    qkfkdkatltvdrssstayiqlssptsedsavyycarddydgafwgqgtlvtvsaakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpapvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2c1pH (H:)
    vqlqqsgaelvrpgtsvklsckasgysftnywmnwlrqrpgqgldwigmihpsdsetrln
    qkfkdkatltvdrssstayiqlssptsedsavyycarddydgafwgqgtlvtvsaakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpapvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1pH (H:)
    vqlqqsgaelvrpgtsvklsckasgysftnywmnwlrqrpgqgldwigmihpsdsetrln
    qkfkdkatltvdrssstayiqlssptsedsavyycarddydgafwgqgtlvtvsaakttp
    psvyplapgsaaqtnsmvtlgclvkgyfpapvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2c1pL (L:)
    elvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvskld
    sgdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelkradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1pL (L:)
    lvmtqspltlsvtigqpasisckssqsllysngktylnwllqrpgqspkrliylvsklds
    gdpdrftgsgsgtdftlkisrveaedlgiyycvqgshfpptfgagtklelkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrne