PDB entry 2c1j

View 2c1j on RCSB PDB site
Description: Molecular basis for the recognition of phosphorylated and phosphoacetylated histone H3 by 14-3-3
Class: signaling protein
Keywords: signaling protein-complex, nucleosome, signaling protein
Deposited on 2005-09-15, released 2005-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-18, with a file datestamp of 2013-09-13.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1J
    • Uniprot P63104 (13-End)
    Domains in SCOPe 2.07: d2c1ja_
  • Chain 'B':
    Compound: 14-3-3 protein zeta/delta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1J
    • Uniprot P63104 (13-End)
    Domains in SCOPe 2.07: d2c1jb_
  • Chain 'C':
    Compound: histone h3 acetylphosphopeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1J (0-7)
  • Chain 'D':
    Compound: histone h3 acetylphosphopeptide
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1J (0-7)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1jA (A:)
    mgsshhhhhhsqdmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsva
    yknvvgarrsswrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflip
    nasqaeskvfylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpir
    lglalnfsvfyyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltl
    wtsdtqgdeaeageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1jA (A:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c1jB (B:)
    mgsshhhhhhsqdmdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsva
    yknvvgarrsswrvvssieqktegaekkqqmareyrekietelrdicndvlsllekflip
    nasqaeskvfylkmkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpir
    lglalnfsvfyyeilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltl
    wtsdtqgdeaeageggen
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1jB (B:)
    mdknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswr
    vvssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylk
    mkgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyye
    ilnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.