PDB entry 2c1i

View 2c1i on RCSB PDB site
Description: structure of streptococcus pnemoniae peptidoglycan deacetylase (sppgda) d 275 n mutant.
Class: hydrolase
Keywords: ce-4, carbohydrate esterase, peptidoglycan deacetylase, metalloenzyme, d275n mutant, hydrolase
Deposited on 2005-09-15, released 2005-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.189
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan glcnac deacetylase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1I
      • engineered mutation (242)
    • Uniprot Q8DP63 (Start-430)
    Domains in SCOPe 2.07: d2c1ia1, d2c1ia2
  • Heterogens: MES, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1iA (A:)
    gplgsfkiyqqksfeqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissv
    relinqdvkdkleskdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgk
    vhltedgqpftldqlfsdaskakeqlikeltsfiedkkieqdqseqivknfsdqdlsawn
    fdykdsqiilypspvvenleeialpvsaffdviqssyllekdaalyqsyfdkkhqkvval
    tfndgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseghvvgnhswshpi
    lsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldlsfimwdvdsldw
    kskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgytfvtipemlntrl
    kahelyysrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1iA (A:)
    feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
    skdnlvfyyteqeesglkgvvnrnvtkqiydieetektslgkvhltedgqpftldqlfsd
    askakeqlikeltsfdlsawnfdykdsqiilyeialpvsaffdviqssyllekdaalyqs
    yfdkkhqkvvaltfndgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseg
    hvvgnhswshpilsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldl
    sfimwdvdsldwkskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgyt
    fvtipemlntrlkahelyysrde