PDB entry 2c1h

View 2c1h on RCSB PDB site
Description: the x-ray structure of chlorobium vibrioforme 5-aminolaevulinic acid dehydratase complexed with a diacid inhibitor
Class: lyase
Keywords: lyase, alad, 5-aminolaevulinic acid dehydratase, heme biosynthesis, magnesium, porphyrin biosynthesis
Deposited on 2005-09-14, released 2005-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.263
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c1ha_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c1hb_
  • Heterogens: MG, DSB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1hA (A:)
    msqldllnivhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfr
    ftidraveeckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelci
    mtdvaldpftpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigai
    realdetdhsdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeve
    ldivegadivmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvm
    mesllcmkragadiiftyyakeaakklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1hA (A:)
    vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
    ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
    tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
    sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
    vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
    agadiiftyyakeaakklr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c1hB (B:)
    msqldllnivhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfr
    ftidraveeckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelci
    mtdvaldpftpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigai
    realdetdhsdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeve
    ldivegadivmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvm
    mesllcmkragadiiftyyakeaakklr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1hB (B:)
    vhrprrlrrtaalrnlvqentltvndlvfplfvmpgtnaveevssmpgsfrftidravee
    ckelydlgiqgidlfgipeqktedgseayndngilqqairaikkavpelcimtdvaldpf
    tpfghdglvkdgiilndetvevlqkmavshaeagadfvspsdmmdgrigairealdetdh
    sdvgilsyaakyassfygpfrdalhsapqfgdkstyqmnpanteeamkeveldivegadi
    vmvkpglayldivwrtkerfdvpvaiyhvsgeyamvkaaaakgwidedrvmmesllcmkr
    agadiiftyyakeaakklr