PDB entry 2c1g

View 2c1g on RCSB PDB site
Description: structure of streptococcus pneumoniae peptidoglycan deacetylase (sppgda)
Class: hydrolase
Keywords: ce-4, carbohydrate esterase, peptidoglycan deacetylase, metalloenzyme, hydrolase
Deposited on 2005-09-14, released 2005-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.211
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peptidoglycan glcnac deacetylase
    Species: Streptococcus pneumoniae [TaxId:171101]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1G
    • Uniprot Q8DP63 (Start-430)
    Domains in SCOPe 2.06: d2c1ga1, d2c1ga2
  • Heterogens: ACT, ZN, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1gA (A:)
    gplgsfkiyqqksfeqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissv
    relinqdvkdkleskdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgk
    vhltedgqpftldqlfsdaskakeqlikeltsfiedkkieqdqseqivknfsdqdlsawn
    fdykdsqiilypspvvenleeialpvsaffdviqssyllekdaalyqsyfdkkhqkvval
    tfddgpnpattpqvletlakydikatffvlgknvsgnedlvkrikseghvvgnhswshpi
    lsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsldlsfimwdvdsldw
    kskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgytfvtipemlntrl
    kahelyysrde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1gA (A:)
    feqkieslkkekddqlsegnqkehfrqgqaeviayyplqgekvissvrelinqdvkdkle
    skdnlvfyyteqeesglkgvvnrnvtkqiydlvafkieetektslgkvhltedgqpftld
    qlfsdaskakeqlikeltsfwnfdykdsqiilyeialpvsaffdviqssyllekdaalyq
    syfdkkhqkvvaltfddgpnpattpqvletlakydikatffvlgknvsgnedlvkrikse
    ghvvgnhswshpilsqlsldeakkqitdtedvltkvlgsssklmrppygaitddirnsld
    lsfimwdvdsldwkskneasilteiqhqvangsivlmhdihsptvnalprvieylknqgy
    tfvtipemlntrlkahelyysrde