PDB entry 2c1f

View 2c1f on RCSB PDB site
Description: the structure of the family 11 xylanase from neocallimastix patriciarum
Class: hydrolase
Keywords: hydrolase, glycosidase
Deposited on 2005-09-14, released 2007-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.168
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bifunctional endo-1,4-beta-xylanase a
    Species: NEOCALLIMASTIX PATRICIARUM [TaxId:4758]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29127 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.06: d2c1fa1, d2c1fa2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c1fA (A:)
    mkftvgngqnqhkgvndgfsyeiwldntggngsmtlgsgatfkaewnaavnrgnflarrg
    ldfgsqkkatdydyigldyaatykqtasasgnsrlcvygwfqnrglngvplveyyiiedw
    vdwvpdaqgkmvtidgaqykifqmdhtgptinggsetfkqyfsvrqqkrtsghitvsdhf
    kewakqgwgignlyevalnaegwqssgvadvtlldvyttpkgsspalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c1fA (A:)
    mkftvgngqnqhkgvndgfsyeiwldntggngsmtlgsgatfkaewnaavnrgnflarrg
    ldfgsqkkatdydyigldyaatykqtasasgnsrlcvygwfqnrglngvplveyyiiedw
    vdwvpdaqgkmvtidgaqykifqmdhtgptinggsetfkqyfsvrqqkrtsghitvsdhf
    kewakqgwgignlyevalnaegwqssgvadvtlldvytt