PDB entry 2c1d

View 2c1d on RCSB PDB site
Description: crystal structure of soxxa from p. pantotrophus
Class: oxidoreductase
Keywords: sulfur oxidation, cytochrome-c-type, oxidoreductase
Deposited on 2005-09-13, released 2005-10-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: 0.161
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: soxa
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: soxx
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c1db_
  • Chain 'C':
    Compound: soxa
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: soxx
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c1dd_
  • Chain 'E':
    Compound: soxa
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: soxx
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c1df_
  • Chain 'G':
    Compound: soxa
    Species: Paracoccus denitrificans [TaxId:266]
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: soxx
    Species: Paracoccus pantotrophus [TaxId:82367]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2c1dh_
  • Heterogens: HEC, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1dB (B:)
    cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
    ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
    naqqiedvvaflvtlke
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1dD (D:)
    cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
    ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
    naqqiedvvaflvtlke
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1dF (F:)
    cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
    ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
    naqqiedvvaflvtlke
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1dH (H:)
    cetapkevvyvegaveasltgapgnpeegvrimttnalgncvachqigalpdvefpgtia
    ppldgagdrwteaqlrgivanakmtfegtfmpafykvdgfvrpgdgfsgkagaeplapil
    naqqiedvvaflvtlke