PDB entry 2c1c

View 2c1c on RCSB PDB site
Description: Structural basis of the resistance of an insect carboxypeptidase to plant protease inhibitors
Class: hydrolase
Keywords: insect, helicoverpa zea, carboxypeptidase, metalloprotease, insensitive, plant inhibitors, hydrolase
Deposited on 2005-09-12, released 2005-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-26, with a file datestamp of 2013-06-21.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.2146
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxypeptidase b
    Species: HELICOVERPA ZEA [TaxId:7113]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1C (0-311)
    Domains in SCOPe 2.07: d2c1ca1
  • Chain 'B':
    Compound: carboxypeptidase b
    Species: HELICOVERPA ZEA [TaxId:7113]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C1C (0-311)
    Domains in SCOPe 2.07: d2c1cb_
  • Heterogens: ZN, Y1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1cA (A:)
    lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
    idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
    ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
    ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
    gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
    vvgarragdlfr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c1cB (B:)
    lpydnyqelevideyldyigekypdvatvvnaaesfegrpikyikisttnfedenkpvif
    idggiharewisppsvtwaihklvedvtendllekfdwillpvvnpdgykytftnerfwr
    ktrstnnnplsqicrgadgnrnfdfvwnsigtsnspcsdiyagtsafsevetrvvrdilh
    ehlarmalyltmhsfgsmilypwghdgslsqnalglhtvgvamasviqsnalpnfppytv
    gnsalvigyyiagssedyahsigvplsytyelpglssgwdgfhlppqyieqvcretwegi
    vvgarragdlfr