PDB entry 2c15

View 2c15 on RCSB PDB site
Description: 5-(4-carboxy-2-oxo-butoxy)-4-oxo-pentanoic acid acid bound to porphobilinogen synthase from pseudomonas aeruginosa
Class: lyase
Keywords: enzyme mechanism, metalloenzyme, porphobilinogen synthase, pseudomonas aeruginosa, lyase, magnesium, metal-binding, porphyrin biosynthesis
Deposited on 2005-09-11, released 2006-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: 0.149
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • conflict (198)
    Domains in SCOPe 2.07: d2c15a_
  • Chain 'B':
    Compound: delta-aminolevulinic acid dehydratase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q59643
      • conflict (198)
    Domains in SCOPe 2.07: d2c15b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c15A (A:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c15A (A:)
    ftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgver
    lsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpel
    giitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgri
    gairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansdea
    lhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwla
    esvilesltafkragadgiltyfakqaaeqlrrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c15B (B:)
    msftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgv
    erlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfp
    elgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdg
    rigairealesaghtnvrvmaysakyasayygpfrdavgsasnlgkgnkatyqmdpansd
    ealhevaadlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngw
    laesvilesltafkragadgiltyfakqaaeqlrrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c15B (B:)
    sftpanraypytrlrrnrrddfsrrlvrenvltvddlilpvfvldgvnqresipsmpgve
    rlsidqllieaeewvalgipalalfpvtpvekksldaaeaynpegiaqratralrerfpe
    lgiitdvaldpftthgqdgildddgyvlndvsidvlvrqalshaeagaqvvapsdmmdgr
    igairealesaghtnvrvmaysakyasayygpfrdavgsnkatyqmdpansdealhevaa
    dlaegadmvmvxpgmpyldivrrvkdefraptfvyqvsgeyamhmgaiqngwlaesvile
    sltafkragadgiltyfakqaaeqlrrg