PDB entry 2c0z

View 2c0z on RCSB PDB site
Description: The 1.6 A resolution crystal structure of NovW: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of Streptomyces spheroides
Class: isomerase
Keywords: isomerase, epimerase, antibiotic biosynthesis, rmlc-like cupin
Deposited on 2005-09-09, released 2006-01-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-03-12, with a file datestamp of 2014-03-07.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.152
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novw
    Species: STREPTOMYCES NIVEUS NCIMB 11891 [TaxId:1352941]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0Z (0-8)
    • Uniprot Q9L9E5 (9-End)
    Domains in SCOPe 2.06: d2c0za1, d2c0za2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0zA (A:)
    sglvprgshmrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanls
    vsvrgvvrgihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrrav
    ylsegighgfcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqda
    lllaeardagllptyatcqavtvpspapgsvgdpgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0zA (A:)
    sglvprgshmrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanls
    vsvrgvvrgihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrrav
    ylsegighgfcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqda
    lllaeardagllptyatcq