PDB entry 2c0z

View 2c0z on RCSB PDB site
Description: the 1.6 a resolution crystal structure of novw: a 4-keto-6-deoxy sugar epimerase from the novobiocin biosynthetic gene cluster of streptomyces spheroides
Class: isomerase
Keywords: epimerase, antibiotic biosynthesis, rmlc-like cupin, isomerase
Deposited on 2005-09-09, released 2006-01-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-25, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.15245
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novw
    Species: STREPTOMYCES SPHAEROIDES
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0Z (0-8)
    • Uniprot Q9L9E5 (9-End)
    Domains in SCOP 1.73: d2c0za1
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0zA (A:)
    sglvprgshmrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanls
    vsvrgvvrgihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrrav
    ylsegighgfcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqda
    lllaeardagllptyatcqavtvpspapgsvgdpgp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0zA (A:)
    sglvprgshmrlrplgiegvweitpeqradprgvfldwyhvdrfaeaigrplrlaqanls
    vsvrgvvrgihfvdvppgqakyvtcvrgavfdvvvdlrvgsptygcwegtrlddvsrrav
    ylsegighgfcaisdeatlcylssgtydpatehgvhpldpelaidwptgtpllsprdqda
    lllaeardagllptyatcq