PDB entry 2c0y

View 2c0y on RCSB PDB site
Description: the crystal structure of a cys25ala mutant of human procathepsin s
Class: hydrolase
Keywords: procathepsin s, proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen
Deposited on 2005-09-08, released 2006-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: procathepsin s
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25774 (Start-314)
      • engineered mutation (122)
      • variant (144)
    Domains in SCOPe 2.08: d2c0ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0yA (A:)
    qlhkdptldhhwhlwkktygkqykekneeavrrliweknlkfvmlhnlehsmgmhsydlg
    mnhlgdmtseevmslmsslrvpsqwqrnityksnpnrilpdsvdwrekgcvtevkyqgsc
    gaawafsavgaleaqlklktgklvslsaqnlvdcstekygnkgcnggfmttafqyiidnk
    gidsdasypykamdqkcqydskyraatcskytelpygredvlkeavankgpvsvgvdarh
    psfflyrsgvyyepsctqnvnhgvlvvgygdlngkeywlvknswghnfgeegyirmarnk
    gnhcgiasfpsypei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0yA (A:)
    lhkdptldhhwhlwkktygkqykekneeavrrliweknlkfvmlhnlehsmgmhsydlgm
    nhlgdmtseevmslmsslrvpsqwqrnityilpdsvdwrekgcvtevkyqgscgaawafs
    avgaleaqlklktgklvslsaqnlvdcstekygnkgcnggfmttafqyiidnkgidsdas
    ypykamdqkcqydskyraatcskytelpygredvlkeavankgpvsvgvdarhpsfflyr
    sgvyyepsctqnvnhgvlvvgygdlngkeywlvknswghnfgeegyirmarnkgnhcgia
    sfpsypei