PDB entry 2c0u

View 2c0u on RCSB PDB site
Description: crystal structure of a covalent complex of nitroalkane oxidase trapped during substrate turnover
Class: oxidoreductase
Keywords: oxidoreductase, n5-fad adduct, flavoenzyme, nitroalkane, acyl-coa dehydrogenase, nitrobutyl, fad, flavoprotein
Deposited on 2005-09-07, released 2006-02-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2014
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c0ua1, d2c0ua2
  • Chain 'B':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c0ub1, d2c0ub2
  • Chain 'C':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c0uc1, d2c0uc2
  • Chain 'D':
    Compound: nitroalkane oxidase
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2c0ud1, d2c0ud2
  • Heterogens: FAD, NBT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0uA (A:)
    mvdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglika
    qvpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpf
    isgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykg
    adlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitt
    sgphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfak
    sdtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtki
    yttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmale
    dyepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0uA (A:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0uB (B:)
    mvdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglika
    qvpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpf
    isgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykg
    adlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitt
    sgphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfak
    sdtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtki
    yttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmale
    dyepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0uB (B:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c0uC (C:)
    mvdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglika
    qvpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpf
    isgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykg
    adlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitt
    sgphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfak
    sdtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtki
    yttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmale
    dyepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0uC (C:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2c0uD (D:)
    mvdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglika
    qvpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpf
    isgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykg
    adlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitt
    sgphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfak
    sdtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtki
    yttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmale
    dyepwaatygsskvdksrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0uD (D:)
    vdfklspsqlearrhaqafantvltkasaeystqkdqlsrfqatrpfyreavrhglikaq
    vpiplggtmeslvhesiileelfavepatsitivatalglmpvilcdspslqekflkpfi
    sgegeplaslmhsepngtanwlqkggpglqttarkvgnewvisgeklwpsnsggwdykga
    dlacvvcrvsddpskpqdpnvdpatqiavllvtretiannkkdayqilgepelaghitts
    gphtrftefhvphenllctpglkaqglvetafamsaalvgamaigtaraafeealvfaks
    dtrggskhiiehqsvadklidckirletsrllvwkavttledealewkvklemamqtkiy
    ttdvavecvidamkavgmksyakdmsfprllnevmcyplfdggniglrrrqmqrvmaled
    yepwaatygs