PDB entry 2c0s

View 2c0s on RCSB PDB site
Description: nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Class: transferase
Keywords: phosphatase, phosphorylation, sporulation, bacillus anthracis, antithetical, negative regulator, spine, transferase
Deposited on 2005-09-07, released 2006-09-25
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-06, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved domain protein
    Species: BACILLUS ANTHRACIS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c0sa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c0sA (A:)
    mnvtklndrieakkkeliylvekygfthhkvisfsqeldrllnllielktkkkryslleh
    hhhh