PDB entry 2c0m

View 2c0m on RCSB PDB site
Description: apo form of the tpr domain of the pex5p receptor
Class: transport protein
Keywords: transport protein, tpr repeat, transport, import receptor complex, peroxisome, disease mutation, protein transport, zellweger syndrome
Deposited on 2005-09-05, released 2006-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.265
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (0-318)
      • conflict (104)
    Domains in SCOPe 2.07: d2c0ma_
  • Chain 'B':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (0-318)
      • conflict (104)
    Domains in SCOPe 2.07: d2c0mb_
  • Chain 'C':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (Start-318)
      • conflict (104)
    Domains in SCOPe 2.07: d2c0mc_
  • Chain 'F':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50542 (Start-318)
      • conflict (104)
    Domains in SCOPe 2.07: d2c0mf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0mA (A:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnl
    sgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsry
    nlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsday
    gaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0mA (A:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsvrpndy
    llwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreavehflea
    lnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0mB (B:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnl
    sgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsry
    nlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsday
    gaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0mB (B:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsvrpndy
    llwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreavehflea
    lnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2c0mC (C:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnl
    sgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsry
    nlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsday
    gaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0mC (C:)
    kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
    neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvr
    ilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsv
    rpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreave
    hflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl
    pq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2c0mF (F:)
    dkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqa
    eneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlv
    tpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnl
    sgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsry
    nlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsday
    gaadardlstlltmfglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0mF (F:)
    kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
    neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvr
    ilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsv
    rpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreave
    hflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfgl
    pq