PDB entry 2c0l

View 2c0l on RCSB PDB site
Description: tpr domain of human pex5p in complex with human mscp2
Class: transport protein/receptor complex
Keywords: tpr repeat, transport, import receptor complex, peroxisome, disease mutation, protein transport, zellweger syndrome, alternative initiation, lipid transport, lipid-binding, mitochondrion, peroxisome, transit peptide, transport protein/receptor complex
Deposited on 2005-09-05, released 2006-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2007-01-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal targeting signal 1 receptor
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: nonspecific lipid-transfer protein
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c0lb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c0lB (B:)
    sasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgsv
    lpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgna
    kl