PDB entry 2c0l

View 2c0l on RCSB PDB site
Description: tpr domain of human pex5p in complex with human mscp2
Class: transport protein/receptor
Keywords: transport protein/receptor, tpr repeat, transport, import receptor complex, peroxisome, disease mutation, protein transport, zellweger syndrome, alternative initiation, lipid transport, lipid-binding, mitochondrion, transit peptide, transport protein-receptor complex
Deposited on 2005-09-05, released 2006-11-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxisomal targeting signal 1 receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c0la_
  • Chain 'B':
    Compound: nonspecific lipid-transfer protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c0lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0lA (A:)
    hpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisalrr
    clelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvtpaeegaggaglgp
    skrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaa
    lsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahre
    avehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltm
    fglpq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0lA (A:)
    hpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqaeneqellaisalrr
    clelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvpskrilgsllsdsl
    flevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsvrpndyllwnk
    lgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreavehflealnmqr
    ksrgprgeggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c0lB (B:)
    sasdgfkanlvfkeiekkleeegeqfvkkiggifafkvkdgpggkeatwvvdvkngkgsv
    lpnsdkkadctitmadsdflalmtgkmnpqsaffqgklkitgnmglamklqnlqlqpgna
    kl