PDB entry 2c0j

View 2c0j on RCSB PDB site
Description: Crystal structure of the bet3-trs33 heterodimer
Class: transport
Keywords: transport, transport protein, endoplasmic reticulum, er-golgi transport, lipoprotein, palmitate
Deposited on 2005-09-03, released 2006-02-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2187
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trafficking protein particle complex subunit 3
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O43617 (0-160)
  Domains in SCOPe 2.08: d2c0ja_
• Chain 'B':
  Compound: r32611_2
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75865 (Start-159)
• Heterogens: PLM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c0jA (A:)
  sselftltygalvtqlckdyendedvnkqldrmgynigvrliedflarsnvgrchdfret
  adviakvafkmylgitpsitnwspagdefslilennplvdfvelpdnhsaliysnllcgv
  lrgalemvqmaveakfvqdtlkgdgvteirmrfirriednl
  

  
  
• Chain 'B':
  No sequence available.