PDB entry 2c0g

View 2c0g on RCSB PDB site
Description: structure of pdi-related chaperone, wind mutant-y53s
Class: chaperone
Keywords: wind, windbeutel, pdi-dbeta, pdi, protein disulfide isomerase, pipe, dorsal-ventral patterning, chaperone, wind mutants, developmental protein, endoplasmic reticulum
Deposited on 2005-09-02, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.222
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: windbeutel protein
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0G
      • engineered mutation (43)
    • Uniprot O44342
    Domains in SCOP 1.75: d2c0ga1, d2c0ga2
  • Chain 'B':
    Compound: windbeutel protein
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0G
      • engineered mutation (43)
    • Uniprot O44342
    Domains in SCOP 1.75: d2c0gb1, d2c0gb2
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0gA (A:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0gA (A:)
    ctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0gB (B:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0gB (B:)
    ctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrv