PDB entry 2c0f

View 2c0f on RCSB PDB site
Description: structure of wind y53f mutant
Class: chaperone
Keywords: chaperone, dorsal-ventral patterning, pdi, pdi-dbeta, pipe, protein disulfide isomerase, wind, windbeutel, wind mutant, developmental protein, endoplasmic reticulum
Deposited on 2005-09-02, released 2006-08-29
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.222
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: windbeutel protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0F
      • engineered mutation (43)
    • Uniprot O44342
    Domains in SCOPe 2.04: d2c0fa1, d2c0fa2
  • Chain 'B':
    Compound: windbeutel protein
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C0F
      • engineered mutation (43)
    • Uniprot O44342
    Domains in SCOPe 2.04: d2c0fb1, d2c0fb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0fA (A:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiafpygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0fA (A:)
    ctgcvdldelsfektverfpysvvkfdiafpygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0fB (B:)
    mrgshhhhhhgsvtctgcvdldelsfektverfpysvvkfdiafpygekheaftafsksa
    hkatkdlliatvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtl
    dnlkafvsantplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqq
    narayliymrkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtk
    tapekeel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0fB (B:)
    tctgcvdldelsfektverfpysvvkfdiafpygekheaftafsksahkatkdlliatvg
    vkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantpl
    yigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkih
    evgydfleeetkrllrlkagkvteakkeellrklnilevfrvh