PDB entry 2c0e

View 2c0e on RCSB PDB site
Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.
Class: chaperone
Keywords: wind, windbeutel, pdi-dbeta, pdi, protein disulfide isomerase, pipe, dorsal-ventral patterning, chaperone, wind mutants, developmental protein, endoplasmic reticulum
Deposited on 2005-09-01, released 2006-08-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.2295
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: windbeutel protein
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c0ea1, d2c0ea2
  • Chain 'B':
    Compound: windbeutel protein
    Species: Drosophila melanogaster
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2c0eb1, d2c0eb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c0eA (A:)
    mgsvtctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlli
    atvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsa
    ntplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliym
    rkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktapekeelr
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0eA (A:)
    ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtkta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2c0eB (B:)
    mgsvtctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlli
    atvgvkdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsa
    ntplyigrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliym
    rkihevgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkvtktapekeelr
    gshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c0eB (B:)
    ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
    kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
    igrdgcikefnevlknyanipdaeqlklieklqakqeqltdpeqqqnarayliymrkihe
    vgydfleeetkrllrlkagkvteakkeellrklnilevfrvhkv