PDB entry 2c08

View 2c08 on RCSB PDB site
Description: rat endophilin a1 bar domain
Class: transferase
Keywords: endocytosis, bar domain, membrane curvature, sh3 domain, acyltransferase, coiled coil, lipid-binding, multigene family, phosphorylation, transferase
Deposited on 2005-08-26, released 2006-06-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-12-20, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.27952
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sh3-containing grb2-like protein 2
    Species: Rattus norvegicus
    Database cross-references and differences (RAF-indexed):
    • PDB 2C08 (43-60)
    • Uniprot O35179 (61-203)
    Domains in SCOP 1.73: d2c08a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c08A (A:)
    egtkldddfkemerkvdvtsravmeimtktieylqpnpasrakpqaeallaeamlkfgre
    lgddcnfgpalgevgeamrelsevkdsldmevkqnfidplqnlhdkdlreiqhhlkkleg
    rrldfdykkkrqgkipdeelrqalekfdeskeiaessmfnllemdieqvsqlsalvqaql
    eyhkqavqilqqvtvrleerirqa