PDB entry 2c06

View 2c06 on RCSB PDB site
Description: NMR-based model of the complex of the toxin Kid and a 5-nucleotide substrate RNA fragment (AUACA)
Class: toxin
Keywords: docking, DNA replication, mazf, plasmid maintenance, post segregational killing, protein-RNA complex, ribonuclease, RNA cleavage, RNAse, toxin-antitoxin, toxin
Deposited on 2005-08-25, released 2006-02-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-15, with a file datestamp of 2020-01-10.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: kid toxin protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c06a1
  • Chain 'B':
    Compound: kid toxin protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2c06b1
  • Chain 'C':
    Compound: 5'-r(*ap*up*ap*cp*ap)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c06A (A:)
    mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs
    ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c06B (B:)
    mergeiwlvsldptagheqqgtrpvlivtpaafnrvtrlpvvvpvtsggnfartagfavs
    ldgvgirttgvvrcdqprtidmkarggkrlervpetimnevlgrlstilt
    

  • Chain 'C':
    No sequence available.