PDB entry 2c05

View 2c05 on RCSB PDB site
Description: crystal structures of eosinophil-derived neurotoxin in complex with the inhibitors 5'-ATP, ap3a, ap4a and ap5a
Class: hydrolase
Keywords: endonuclease, eosinophil, hydrolase, nuclease, ribonuclease, RNAse us, RNAse-2, inhibitor, 5'-ATP, ap3a, ap4a, ap5a, chemotaxis, glycoprotein, polymorphism, sensory transduction
Deposited on 2005-08-25, released 2006-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.185
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: nonsecretory ribonuclease
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 2C05 (0-0)
  • Uniprot P10153 (1-134)
  Domains in SCOPe 2.08: d2c05a2, d2c05a3
• Heterogens: ACY, B4P, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2c05A (A:)
  mkppqftwaqwfetqhinmtsqqctnamqvinnyqrrcknqntfllttfanvvnvcgnpn
  mtcpsnktrknchhsgsqvplihcnlttpspqnisncryaqtpanmfyivacdnrdqrrd
  ppqypvvpvhldrii