PDB entry 2c03

View 2c03 on RCSB PDB site
Description: GDP complex of srp gtpase ffh ng domain
Class: signaling protein
Keywords: ffh, gmppnp, GTP-binding, ng domain, RNA-binding, signaling protein, srp54 nucleotide-binding, signal protein
Deposited on 2005-08-25, released 2007-02-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-10-16, with a file datestamp of 2019-10-11.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: N/A
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C03 (0-0)
      • conflict (47)
    • Uniprot O07347 (1-End)
    Domains in SCOPe 2.08: d2c03a1, d2c03a2
  • Chain 'B':
    Compound: signal recognition particle protein
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • PDB 2C03 (0-0)
      • conflict (47)
    • Uniprot O07347 (1-296)
    Domains in SCOPe 2.08: d2c03b1, d2c03b2
  • Heterogens: GDP, EDO, DIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2c03A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2c03A (A:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c03B (B:)
    mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreeal
    gkqvlesltpaevilatvyealkealggearlpvlkdrnlwflvglqgsgktttaaklal
    yykgkgrrpllvaadtqrpaareqlrllgekvgvpvlevmdgespesirrrveekarlea
    rdlilvdtagrlqideplmgelarlkevlgpdevllvldamtgqealsvarafdekvgvt
    glvltkldgdarggaalsarhvtgkpiyfagvsekpeglepfyperlagrilgmgdv